PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008231091.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family TCP
Protein Properties Length: 306aa    MW: 32821.5 Da    PI: 9.5482
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008231091.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP127.21.7e-3965150287
             TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsss 87 
                     a+k+++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++ti+WLlqqa+p+i+++tgt++++as+ +a+  s+s++  s 
  XP_008231091.1  65 APKRSSNKDRHTKVEGRGRRIRMPALCAARIFQLTRELGHKSDGETIQWLLQQAEPSIIAATGTGTIPASALTAAGGSVSQQGTSL 150
                     789******************************************************************99955555555543333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.1E-3170164IPR005333Transcription factor, TCP
PROSITE profilePS5136928.01671125IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008361Biological Processregulation of cell size
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0000987Molecular Functioncore promoter proximal region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MDPKGSKQTQ EIPSFLSLPQ PQQQQQQQQQ QQQQQQPNMS ENKPAEIKDF QIVIADKEEG  60
KKQLAPKRSS NKDRHTKVEG RGRRIRMPAL CAARIFQLTR ELGHKSDGET IQWLLQQAEP  120
SIIAATGTGT IPASALTAAG GSVSQQGTSL SAGLHQKIDE LGGSSIGSGS RTSWAMVGGN  180
LGRPHVATGL WPPVSSFGFQ SSSGPSTTNL GSESSNYMQK IGFPGFDLPV SNMGPMSFTS  240
ILGGGSNQQL PGLELGLSQD GHIGVLNSQA LSQIYQQMGH ARVHQHQHQH QHQQPPAKDD  300
SQGSGQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00636PBMTransfer from Glyma.19G095300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008231091.10.0PREDICTED: transcription factor TCP20
SwissprotQ9LSD53e-89TCP20_ARATH; Transcription factor TCP20
TrEMBLF6H4631e-167F6H463_VITVI; Putative uncharacterized protein
TrEMBLM5WYR61e-167M5WYR6_PRUPE; Uncharacterized protein
STRINGVIT_14s0068g01690.t011e-166(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33393269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27010.11e-79TCP family protein